PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN02775.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family bHLH
Protein Properties Length: 248aa    MW: 28353.1 Da    PI: 9.1573
Description bHLH family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN02775.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HLH36.67.9e-1276128155
                 CHHHHHHHHHHHHHHHHHHHHHHHCTSCCC...TTS-STCHHHHHHHHHHHHHHH CS
         HLH   1 rrrahnerErrRRdriNsafeeLrellPkaskapskKlsKaeiLekAveYIksLq 55 
                 +++ h e+Er+RR+++ +  + Lr+llP ++   ++K s ++   +Av+YI++Lq
  KHN02775.1  76 KKMVHREIERQRRQEMATLHASLRSLLPLRF--IKGKRSISDQMNEAVNYINHLQ 128
                 6889*************************65..*********************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5088812.87475127IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
SuperFamilySSF474592.62E-1275146IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
PfamPF000106.6E-976128IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene3DG3DSA:4.10.280.105.8E-1076144IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
CDDcd000831.48E-776132No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 248 aa     Download sequence    Send to blast
MFPLQRGNEL VIHFSNGLYP QHKISQDLIR DDQNIDQSPH VGYSDKKWRT SRPKKLFYHE  60
AAATSHANSS NQEYAKKMVH REIERQRRQE MATLHASLRS LLPLRFIKGK RSISDQMNEA  120
VNYINHLQKN IKELSDKRDK LKKKPSINST PEGHENCKHV SSGFTIHQNS GGAVGIEISG  180
FSEEEVPLSK LLELVLEERL EVVSCLSTKV NGRLLHSLQC EVDNSDSVDL SELRRKFSNV  240
IPSLRCSE
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKT0311160.0KT031116.1 Glycine max clone HN_CCL_215 bHLH transcription factor (Glyma10g38630.1) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003536495.10.0PREDICTED: transcription factor bHLH118-like
TrEMBLA0A0B2P0I30.0A0A0B2P0I3_GLYSO; Transcription factor bHLH126
STRINGGLYMA10G38630.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF79233125
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G25400.14e-30bHLH family protein
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]